PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof004079
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 223aa    MW: 23888.1 Da    PI: 10.8469
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-69086PU_refplantGDBView CDS
gnl|UG|Sof#S17276151PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.96.4e-1599143347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ Ia+ + ++Rt+ q+ s+ qky
        Sof004079  99 PWTEEEHRTFLAGLEKLGKGDWRGIAKNFVTTRTPTQVASHAQKY 143
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.96892148IPR017930Myb domain
SuperFamilySSF466895.89E-1893148IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-1895147IPR006447Myb domain, plants
SMARTSM007171.4E-1196146IPR001005SANT/Myb domain
CDDcd001676.38E-1199144No hitNo description
Gene3DG3DSA:1.10.10.601.7E-1299142IPR009057Homeodomain-like
PfamPF002491.0E-1299143IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MPRDSRRAGM RLFGVTIALA PEGDPPERDP SPNPPVAARE DVMRKCKSMG NLAALVAGAD  60
GGGGSANGGG AGDGYLSDGG LTQSSGKRRR AQERKKAVPW TEEEHRTFLA GLEKLGKGDW  120
RGIAKNFVTT RTPTQVASHA QKYFLRQTNP NKKKRRSSLF DMMPRELSPT PNCPILPPSM  180
AKVHDVVTMT KQLQNSNLEG ASSSNAANVA SKVGRDPPPV PSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151155KKKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.136480.0bud| inflorescence| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008676506.11e-134PREDICTED: putative MYB DNA-binding domain superfamily protein isoform X1
SwissprotQ8S9H75e-34DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0C6WCT91e-161A0A0C6WCT9_9POAL; ScMYB52 protein
STRINGGRMZM2G157306_P021e-132(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.14e-39MYB_related family protein